PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa011819
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 202aa    MW: 23338.8 Da    PI: 5.6527
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-51108PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.2e-151656648
                     HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     + E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
        Lsa011819 16 PHEERLVLEYHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 56
                     68***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.762660IPR017930Myb domain
SMARTSM007177.7E-111058IPR001005SANT/Myb domain
PfamPF002498.7E-131655IPR001005SANT/Myb domain
CDDcd001671.65E-101656No hitNo description
SuperFamilySSF466892.34E-111660IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-191657IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MGELSASGVE KRKDDPHEER LVLEYHSKWG NRWSRIARKL PGRTDNEIKN YWRTHMRKKA  60
QEHKRVSSPS SSFSNSSSSS SICTNDPTVQ SMPMNETKER SFYDTGGIEM VPASRGKNTN  120
TSMKHNKDTS EEQEKIYSMD EIWKDIDLLE NDDLKPSFDH YSDVTPSRIW DYSVNSFWMM  180
DGGQQEFGTD MFFPATSELL TG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651059.14e-50PREDICTED: transcription factor MYB59
SwissprotQ9LX822e-39MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A103Y6W22e-57A0A103Y6W2_CYNCS; Homeodomain-like protein
STRINGVIT_06s0004g04140.t011e-49(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.32e-38myb domain protein 48